Lineage for d1d4da3 (1d4d A:360-505)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681978Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 1681979Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 1681980Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 1681987Protein Flavocytochrome c3 (respiratory fumarate reductase) [56432] (2 species)
    contains additional N-terminal multiheme domain
  7. 1682012Species Shewanella putrefaciens [TaxId:24] [56434] (3 PDB entries)
  8. 1682013Domain d1d4da3: 1d4d A:360-505 [42322]
    Other proteins in same PDB: d1d4da1, d1d4da2
    complexed with fad, hem, sin

Details for d1d4da3

PDB Entry: 1d4d (more details), 2.5 Å

PDB Description: crystal structure of the succinate complexed form of the flavocytochrome c fumarate reductase of shewanella putrefaciens strain mr-1
PDB Compounds: (A:) flavocytochrome c fumarate reductase

SCOPe Domain Sequences for d1d4da3:

Sequence, based on SEQRES records: (download)

>d1d4da3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]}
yiqahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylv
fddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqf
erpdlprelvvapfyaleiapavhht

Sequence, based on observed residues (ATOM records): (download)

>d1d4da3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]}
yiqahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylv
fddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvsgkdaqfe
rpdlprelvvapfyaleiapavhht

SCOPe Domain Coordinates for d1d4da3:

Click to download the PDB-style file with coordinates for d1d4da3.
(The format of our PDB-style files is described here.)

Timeline for d1d4da3: