SCOPe 2.07: Domain d1qo8a3: 1qo8 A:360-505

Lineage for d1qo8a3 (1qo8 A:360-505)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
   unusual fold

4. Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family)

5. Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)

6. Protein Flavocytochrome c3 (respiratory fumarate reductase) [56432] (2 species)
   contains additional N-terminal multiheme domain

7. Species Shewanella frigidimarina [TaxId:56812] [56433] (16 PDB entries)

8. Domain d1qo8a3: 1qo8 A:360-505 [42316]
   Other proteins in same PDB: d1qo8a1, d1qo8a2, d1qo8d1, d1qo8d2
   complexed with fad, hem

Details for d1qo8a3

PDB Entry: 1qo8, 2.15 Å

PDB Description: the structure of the open conformation of a flavocytochrome c3 fumarate reductase

PDB Compounds: (A:) flavocytochrome c3 fumarate reductase

SCOPe Domain Sequences for d1qo8a3:

Sequence; same for both SEQRES and ATOM records:

>d1qo8a3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}
hptvgkdsrilisetvrgvgavmvnkdgnrfiselttrdkasdailkqpgqfawiifdnq
lykkakmvrgydhlemlykgdtveqlakstgmkvadlaktvsdyngyvasgkdtafgrad
mplnmtqspyyavkvapgihhtmggv

Timeline for d1qo8a3:

• d1qo8a3 first appeared (with stable ids) in SCOP 1.55
  
• d1qo8a3 appears in SCOPe 2.06
  
• d1qo8a3 appears in the current release, SCOPe 2.08