Lineage for d1qlaa3 (1qla A:251-371)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336698Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 336699Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 336700Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 336733Protein Fumarate reductase [56429] (2 species)
  7. 336741Species Wolinella succinogenes [TaxId:844] [56431] (3 PDB entries)
  8. 336742Domain d1qlaa3: 1qla A:251-371 [42310]
    Other proteins in same PDB: d1qlaa1, d1qlaa2, d1qlab1, d1qlab2, d1qlac_, d1qlad1, d1qlad2, d1qlae1, d1qlae2, d1qlaf_

Details for d1qlaa3

PDB Entry: 1qla (more details), 2.2 Å

PDB Description: respiratory complex ii-like fumarate reductase from wolinella succinogenes

SCOP Domain Sequences for d1qlaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlaa3 d.168.1.1 (A:251-371) Fumarate reductase {Wolinella succinogenes}
meavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelasrdvvsrrmie
hirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaekwapvlpmqhy
s

SCOP Domain Coordinates for d1qlaa3:

Click to download the PDB-style file with coordinates for d1qlaa3.
(The format of our PDB-style files is described here.)

Timeline for d1qlaa3: