Lineage for d1dff__ (1dff -)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 421176Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 421177Superfamily d.167.1: Peptide deformylase [56420] (1 family) (S)
    nickel-dependent enzyme
  5. 421178Family d.167.1.1: Peptide deformylase [56421] (1 protein)
  6. 421179Protein Peptide deformylase [56422] (8 species)
  7. 421182Species Escherichia coli [TaxId:562] [56423] (15 PDB entries)
  8. 421215Domain d1dff__: 1dff - [42304]
    complexed with zn

Details for d1dff__

PDB Entry: 1dff (more details), 2.88 Å

PDB Description: peptide deformylase

SCOP Domain Sequences for d1dff__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dff__ d.167.1.1 (-) Peptide deformylase {Escherichia coli}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrl

SCOP Domain Coordinates for d1dff__:

Click to download the PDB-style file with coordinates for d1dff__.
(The format of our PDB-style files is described here.)

Timeline for d1dff__: