SCOP 1.71: Domain d1bs5c_: 1bs5 C:

Lineage for d1bs5c_ (1bs5 C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (1 family)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (1 protein)

6. Protein Peptide deformylase [56422] (9 species)

7. Species Escherichia coli [TaxId:562] [56423] (15 PDB entries)

8. Domain d1bs5c_: 1bs5 C: [42298]
   complexed with so4, zn3

Details for d1bs5c_

PDB Entry: 1bs5, 2.5 Å

PDB Description: peptide deformylase as zn2+ containing form

SCOP Domain Sequences for d1bs5c_:

Sequence; same for both SEQRES and ATOM records:

>d1bs5c_ d.167.1.1 (C:) Peptide deformylase {Escherichia coli}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara

Timeline for d1bs5c_:

• d1bs5c_ first appeared (with stable ids) in SCOP 1.55
  
• d1bs5c_ appears in SCOP 1.69
  
• d1bs5c_ appears in SCOP 1.73
  
• d1bs5c_ appears in the current release, SCOPe 2.08