Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (1 family) nickel-dependent enzyme |
Family d.167.1.1: Peptide deformylase [56421] (1 protein) |
Protein Peptide deformylase [56422] (9 species) |
Species Escherichia coli [TaxId:562] [56423] (15 PDB entries) |
Domain d1bs5c_: 1bs5 C: [42298] complexed with so4, zn3 |
PDB Entry: 1bs5 (more details), 2.5 Å
SCOP Domain Sequences for d1bs5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bs5c_ d.167.1.1 (C:) Peptide deformylase {Escherichia coli} svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara
Timeline for d1bs5c_: