![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (1 family) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.1: Peptide deformylase [56421] (1 protein) |
![]() | Protein Peptide deformylase [56422] (7 species) |
![]() | Species Escherichia coli [TaxId:562] [56423] (15 PDB entries) |
![]() | Domain d1bs5a_: 1bs5 A: [42296] |
PDB Entry: 1bs5 (more details), 2.5 Å
SCOP Domain Sequences for d1bs5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bs5a_ d.167.1.1 (A:) Peptide deformylase {Escherichia coli} svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara
Timeline for d1bs5a_: