Lineage for d7vnm0_ (7vnm 0:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021592Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 3021593Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 3021594Family f.3.1.1: Light-harvesting complex subunits [56919] (2 proteins)
  6. 3021647Protein automated matches [404989] (4 species)
    not a true protein
  7. 3086375Species Cereibacter sphaeroides [TaxId:272943] [422692] (1 PDB entry)
  8. 3086421Domain d7vnm0_: 7vnm 0: [422738]
    Other proteins in same PDB: d7vnm1_, d7vnm7_, d7vnm9_, d7vnma_, d7vnmd_, d7vnmf_, d7vnmi_, d7vnmk_, d7vnml_, d7vnmm_, d7vnmo_, d7vnmq_, d7vnms_, d7vnmu_, d7vnmw_
    automated match to d1jo5a_
    complexed with bcl, bph, cdl, fe2, pc1, spo, u10

Details for d7vnm0_

PDB Entry: 7vnm (more details), 2.86 Å

PDB Description: rba sphaeroides pufy-ko rc-lh1 monomer
PDB Compounds: (0:) Light-harvesting protein B-875 beta chain

SCOPe Domain Sequences for d7vnm0_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7vnm0_ f.3.1.1 (0:) automated matches {Cereibacter sphaeroides [TaxId: 272943]}
dlgytgltdeqaqelhsvymsglwlfsavaivahlavyiwrpwf

SCOPe Domain Coordinates for d7vnm0_:

Click to download the PDB-style file with coordinates for d7vnm0_.
(The format of our PDB-style files is described here.)

Timeline for d7vnm0_:

  • d7vnm0_ is new in SCOPe 2.08-stable