SCOPe 2.03: Domain d1xtc.1: 1xtc A:,C:

Lineage for d1xtc.1 (1xtc A:,C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Cholera toxin [56410] (1 species)

7. Species Vibrio cholerae [TaxId:666] [56411] (9 PDB entries)

8. Domain d1xtc.1: 1xtc A:,C: [42259]
   Other proteins in same PDB: d1xtcd_, d1xtce_, d1xtcf_, d1xtcg_, d1xtch_

Details for d1xtc.1

PDB Entry: 1xtc, 2.4 Å

PDB Description: cholera toxin

PDB Compounds: (A:) cholera toxin, (C:) cholera toxin

SCOPe Domain Sequences for d1xtc.1:

Sequence; same for both SEQRES and ATOM records:

>g1xtc.1 d.166.1.1 (A:,C:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
stsislrsahlvgqtilsghstyylyvlatapnmfnvndvlgaysphpdeqevsalggip
ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
hhappgcgnaprXsntcdektqslgvkfldeyqskvkrqifsgyqsdidthnrikdel

Timeline for d1xtc.1:

• d1xtc.1 first appeared (with stable ids) in SCOP 1.55
  
• d1xtc.1 appears in SCOPe 2.02
  
• d1xtc.1 appears in SCOPe 2.04
  
• d1xtc.1 appears in the current release, SCOPe 2.08