Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.0: automated matches [191322] (1 protein) not a true family |
Protein automated matches [190120] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries) |
Domain d7m2ke_: 7m2k E: [422093] Other proteins in same PDB: d7m2kb1, d7m2kb2, d7m2kd1, d7m2kd2, d7m2kf_, d7m2kh_ automated match to d4mdka_ complexed with gzm |
PDB Entry: 7m2k (more details), 2.47 Å
SCOPe Domain Sequences for d7m2ke_:
Sequence, based on SEQRES records: (download)
>d7m2ke_ d.20.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpi dypysppafrfltkmwhpniyetgdvcisilhppvddpqsgelpserwnptqnvrtills visllnepntfspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgvkvp
>d7m2ke_ d.20.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpi dypysppafrfltkmwhpniyetgdvcisilptqnvrtillsvisllnepntfspanvda svmyrkwkeskgkdreytdiirkqvlgtkvdaerdgvkvp
Timeline for d7m2ke_: