Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (40 species) not a true protein |
Species Aspergillus terreus [TaxId:33178] [421560] (3 PDB entries) |
Domain d7ecrb1: 7ecr B:1-187 [421644] automated match to d1bvua2 complexed with a2r, gol, sin |
PDB Entry: 7ecr (more details), 1.73 Å
SCOPe Domain Sequences for d7ecrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ecrb1 c.58.1.0 (B:1-187) automated matches {Aspergillus terreus [TaxId: 33178]} msnlpvepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvwendkgev qvnrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfd pkgksdseirrfcvafmtelcrhigadtdvpagdigvtgreigylfgqyrklrnswegvl tgkggsw
Timeline for d7ecrb1: