Lineage for d7ecrb1 (7ecr B:1-187)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 3085243Species Aspergillus terreus [TaxId:33178] [421560] (3 PDB entries)
  8. 3085327Domain d7ecrb1: 7ecr B:1-187 [421644]
    automated match to d1bvua2
    complexed with a2r, gol, sin

Details for d7ecrb1

PDB Entry: 7ecr (more details), 1.73 Å

PDB Description: crystal structure of aspergillus terreus glutamate dehydrogenase (atgdh) complexed with succinate and adp-ribose
PDB Compounds: (B:) glutamate dehydrogenase

SCOPe Domain Sequences for d7ecrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ecrb1 c.58.1.0 (B:1-187) automated matches {Aspergillus terreus [TaxId: 33178]}
msnlpvepefeqaykelastlenstlfqknpeyrkalavvsvperviqfrvvwendkgev
qvnrgfrvqfnsalgpykgglrfhpsvnlsilkflgfeqifknaltglnmgggkggsdfd
pkgksdseirrfcvafmtelcrhigadtdvpagdigvtgreigylfgqyrklrnswegvl
tgkggsw

SCOPe Domain Coordinates for d7ecrb1:

Click to download the PDB-style file with coordinates for d7ecrb1.
(The format of our PDB-style files is described here.)

Timeline for d7ecrb1:

  • d7ecrb1 is new in SCOPe 2.08-stable