SCOP 1.55: Domain d4crxb2: 4crx B:130-341

Lineage for d4crxb2 (4crx B:130-341)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)

6. Protein Cre recombinase [56355] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [56356] (5 PDB entries)

8. Domain d4crxb2: 4crx B:130-341 [42156]
   Other proteins in same PDB: d4crxa1, d4crxb1

Details for d4crxb2

PDB Entry: 4crx, 2.2 Å

PDB Description: asymmetric dna-bending in the cre-loxp site-specific recombination synapse

SCOP Domain Sequences for d4crxb2:

Sequence; same for both SEQRES and ATOM records:

>d4crxb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllkiaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

Timeline for d4crxb2:

• d4crxb2 appears in SCOP 1.57
  
• d4crxb2 appears in the current release, SCOPe 2.08