SCOPe 2.08: Domain d7dqza_: 7dqz A:

Lineage for d7dqza_ (7dqz A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
   contains an extra alpha-helical domain

7. Species SARS coronavirus [TaxId:227859] [89349] (86 PDB entries)

8. Domain d7dqza_: 7dqz A: [421369]
   automated match to d1z1ja_

Details for d7dqza_

PDB Entry: 7dqz, 1.99 Å

PDB Description: crystal structure of sars 3c-like protease in apo form

PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d7dqza_:

Sequence; same for both SEQRES and ATOM records:

>d7dqza_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
gfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirk
snhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngs
psgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkf
ygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyep
ltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrq

Timeline for d7dqza_:

• d7dqza_ is new in SCOPe 2.08-stable