Lineage for d1bmda2 (1bmd A:155-332)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 613582Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 613583Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 613584Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 613677Protein Malate dehydrogenase [56329] (11 species)
  7. 613749Species Thermus flavus [TaxId:274] [56334] (2 PDB entries)
  8. 613752Domain d1bmda2: 1bmd A:155-332 [42106]
    Other proteins in same PDB: d1bmda1, d1bmdb1

Details for d1bmda2

PDB Entry: 1bmd (more details), 1.9 Å

PDB Description: determinants of protein thermostability observed in the 1.9 angstroms crystal structure of malate dehydrogenase from the thermophilic bacterium thermus flavus

SCOP Domain Sequences for d1bmda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmda2 d.162.1.1 (A:155-332) Malate dehydrogenase {Thermus flavus}
trldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewye
kvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygip
egivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli

SCOP Domain Coordinates for d1bmda2:

Click to download the PDB-style file with coordinates for d1bmda2.
(The format of our PDB-style files is described here.)

Timeline for d1bmda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bmda1