Lineage for d7d8ma1 (7d8m A:58-502)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 3084689Species Irpex lacteus [TaxId:5319] [421006] (1 PDB entry)
  8. 3084690Domain d7d8ma1: 7d8m A:58-502 [421007]
    Other proteins in same PDB: d7d8ma2
    automated match to d4au9a_
    complexed with hem, oxy

Details for d7d8ma1

PDB Entry: 7d8m (more details), 2 Å

PDB Description: crystal structure of dyp
PDB Compounds: (A:) dye-decolorizing peroxidase

SCOPe Domain Sequences for d7d8ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d8ma1 d.58.4.0 (A:58-502) automated matches {Irpex lacteus [TaxId: 5319]}
slpfeniqgdilvgmkkdkekfvffhinnatafksvlktyapanitsvatiigpvanqpl
afvnlafshagfgalnvtddlqdtafsdgqfkdspnlgddtstweeafkgtnvdgvflig
sndesitaqyrddlnakfgdawtivydldsaarpgnekghehfgyldgisnptipgfgtp
hpgqavvdpgiiftgrskdpvmnrpswaldgsflvfrklkqlvpefnkyvldnalqnqag
nltveegaellgsrmfgrwksgapidlspdfddpalgndiernnnfnyshpgsdlatdqt
rcpftahirktnprdlegqglfgdtfhairagtpygpevtdyeassntttidrglafvey
qsvigngfrfqqqawannprfpfskgpsiqlgldpvigqgspretfgldprnasesftvp
qviisnggeyffspsitaivekfaa

SCOPe Domain Coordinates for d7d8ma1:

Click to download the PDB-style file with coordinates for d7d8ma1.
(The format of our PDB-style files is described here.)

Timeline for d7d8ma1:

  • d7d8ma1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7d8ma2