Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (33 species) not a true protein |
Species Irpex lacteus [TaxId:5319] [421006] (1 PDB entry) |
Domain d7d8ma1: 7d8m A:58-502 [421007] Other proteins in same PDB: d7d8ma2 automated match to d4au9a_ complexed with hem, oxy |
PDB Entry: 7d8m (more details), 2 Å
SCOPe Domain Sequences for d7d8ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d8ma1 d.58.4.0 (A:58-502) automated matches {Irpex lacteus [TaxId: 5319]} slpfeniqgdilvgmkkdkekfvffhinnatafksvlktyapanitsvatiigpvanqpl afvnlafshagfgalnvtddlqdtafsdgqfkdspnlgddtstweeafkgtnvdgvflig sndesitaqyrddlnakfgdawtivydldsaarpgnekghehfgyldgisnptipgfgtp hpgqavvdpgiiftgrskdpvmnrpswaldgsflvfrklkqlvpefnkyvldnalqnqag nltveegaellgsrmfgrwksgapidlspdfddpalgndiernnnfnyshpgsdlatdqt rcpftahirktnprdlegqglfgdtfhairagtpygpevtdyeassntttidrglafvey qsvigngfrfqqqawannprfpfskgpsiqlgldpvigqgspretfgldprnasesftvp qviisnggeyffspsitaivekfaa
Timeline for d7d8ma1: