Lineage for d7bgie_ (7bgi E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783857Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2783858Protein automated matches [191237] (8 species)
    not a true protein
  7. 2783899Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370429] (7 PDB entries)
  8. 3084451Domain d7bgie_: 7bgi E: [420768]
    Other proteins in same PDB: d7bgi1_, d7bgi2_, d7bgi3_, d7bgi4_, d7bgi5_, d7bgi6_, d7bgi7_, d7bgi8_, d7bgi9_, d7bgia_, d7bgib_, d7bgic_, d7bgid_, d7bgif_, d7bgij_, d7bgil_, d7bgiz_
    automated match to d6ijje_
    complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, dao, dga, dgd, lhg, lmg, lmt, lpx, lut, nkp, oca, plm, pqn, qtb, rrx, sf4, sph, sqd, t7x; mutant

Details for d7bgie_

PDB Entry: 7bgi (more details), 2.54 Å

PDB Description: photosystem i of a temperature sensitive mutant chlamydomonas reinhardtii
PDB Compounds: (E:) Photosystem I reaction center subunit IV, chloroplastic

SCOPe Domain Sequences for d7bgie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bgie_ b.34.4.0 (E:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
evgpkrgslvkilrpesywfnqvgkvvsvdqsgvrypvvvrfenqnyagvttnnyaldev
vaa

SCOPe Domain Coordinates for d7bgie_:

Click to download the PDB-style file with coordinates for d7bgie_.
(The format of our PDB-style files is described here.)

Timeline for d7bgie_:

  • d7bgie_ is new in SCOPe 2.08-stable