Lineage for d7atec_ (7ate C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027151Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 3027152Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) (S)
    automatically mapped to Pfam PF00510
  5. 3027276Family f.25.1.0: automated matches [393699] (1 protein)
    not a true family
  6. 3027277Protein automated matches [393700] (2 species)
    not a true protein
  7. 3084169Species Paracoccus denitrificans [TaxId:266] [420486] (4 PDB entries)
  8. 3084254Domain d7atec_: 7ate C: [420571]
    Other proteins in same PDB: d7atea_, d7ated_
    automated match to d2occc_
    complexed with ca, cu, cua, hea, mn, pc1, peo, pgv

Details for d7atec_

PDB Entry: 7ate (more details), 2.4 Å

PDB Description: cytochrome c oxidase structure in p-state
PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d7atec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7atec_ f.25.1.0 (C:) automated matches {Paracoccus denitrificans [TaxId: 266]}
nhdyqilppsiwpffgaigafvmltgavawmkgitffglpvegpwmfliglvgvlyvmfg
wwadvvnegetgehtpvvriglqygfilfimsevmffvawfwafiknalypmgpdspikd
gvwppegivtfdpwhlplintlilllsgvavtwahhafvlegdrkttinglivavilgvc
ftglqayeyshaafgladtvyagafymatgfhgahviigtiflfvclirllkgqmtqkqh
vgfeaaawywhfvdvvwlflfvviyiwgr

SCOPe Domain Coordinates for d7atec_:

Click to download the PDB-style file with coordinates for d7atec_.
(The format of our PDB-style files is described here.)

Timeline for d7atec_:

  • d7atec_ is new in SCOPe 2.08-stable