Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) automatically mapped to Pfam PF00510 |
Family f.25.1.0: automated matches [393699] (1 protein) not a true family |
Protein automated matches [393700] (2 species) not a true protein |
Species Paracoccus denitrificans [TaxId:266] [420486] (4 PDB entries) |
Domain d7atec_: 7ate C: [420571] Other proteins in same PDB: d7atea_, d7ated_ automated match to d2occc_ complexed with ca, cu, cua, hea, mn, pc1, peo, pgv |
PDB Entry: 7ate (more details), 2.4 Å
SCOPe Domain Sequences for d7atec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7atec_ f.25.1.0 (C:) automated matches {Paracoccus denitrificans [TaxId: 266]} nhdyqilppsiwpffgaigafvmltgavawmkgitffglpvegpwmfliglvgvlyvmfg wwadvvnegetgehtpvvriglqygfilfimsevmffvawfwafiknalypmgpdspikd gvwppegivtfdpwhlplintlilllsgvavtwahhafvlegdrkttinglivavilgvc ftglqayeyshaafgladtvyagafymatgfhgahviigtiflfvclirllkgqmtqkqh vgfeaaawywhfvdvvwlflfvviyiwgr
Timeline for d7atec_: