Lineage for d7a2nc_ (7a2n C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783006Protein Fyn proto-oncogene tyrosine kinase, SH3 domain [50048] (2 species)
  7. 2783010Species Human (Homo sapiens) [TaxId:9606] [50049] (32 PDB entries)
  8. 3083843Domain d7a2nc_: 7a2n C: [420160]
    automated match to d3ua6b_
    complexed with fmt, na; mutant

Details for d7a2nc_

PDB Entry: 7a2n (more details), 1.4 Å

PDB Description: crystal structure of the fyn sh3 domain a95s-d99t mutant in space group p21
PDB Compounds: (C:) Tyrosine-protein kinase Fyn

SCOPe Domain Sequences for d7a2nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7a2nc_ b.34.2.1 (C:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
tlfvalydyesrtetdlsfhkgekfqilnssegdwwearslttgetgyipsnyvapvd

SCOPe Domain Coordinates for d7a2nc_:

Click to download the PDB-style file with coordinates for d7a2nc_.
(The format of our PDB-style files is described here.)

Timeline for d7a2nc_:

  • d7a2nc_ appears in periodic updates to SCOPe 2.08 starting on 2022-02-08