Lineage for d1g4bn_ (1g4b N:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512789Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 512790Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 512929Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 512930Protein HslV (ClpQ) protease [56258] (3 species)
    dodecameric prokaryotic homologue of proteasome
  7. 512931Species Escherichia coli [TaxId:562] [56259] (7 PDB entries)
  8. 512964Domain d1g4bn_: 1g4b N: [41986]
    Other proteins in same PDB: d1g4be_, d1g4bf_, d1g4bk_, d1g4bl_

Details for d1g4bn_

PDB Entry: 1g4b (more details), 7 Å

PDB Description: crystal structures of the hslvu peptidase-atpase complex reveal an atp-dependent proteolysis mechanism

SCOP Domain Sequences for d1g4bn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g4bn_ d.153.1.4 (N:) HslV (ClpQ) protease {Escherichia coli}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy

SCOP Domain Coordinates for d1g4bn_:

Click to download the PDB-style file with coordinates for d1g4bn_.
(The format of our PDB-style files is described here.)

Timeline for d1g4bn_: