Lineage for d1pmaz_ (1pma Z:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2597201Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2599436Species Thermoplasma acidophilum [TaxId:2303] [56253] (7 PDB entries)
  8. 2599478Domain d1pmaz_: 1pma Z: [41873]
    Other proteins in same PDB: d1pmaa_, d1pmac_, d1pmad_, d1pmae_, d1pmaf_, d1pmag_, d1pmah_, d1pmai_, d1pmaj_, d1pmak_, d1pmal_, d1pmam_, d1pman_, d1pmao_

Details for d1pmaz_

PDB Entry: 1pma (more details), 3.4 Å

PDB Description: proteasome from thermoplasma acidophilum
PDB Compounds: (Z:) proteasome

SCOPe Domain Sequences for d1pmaz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmaz_ d.153.1.4 (Z:) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOPe Domain Coordinates for d1pmaz_:

Click to download the PDB-style file with coordinates for d1pmaz_.
(The format of our PDB-style files is described here.)

Timeline for d1pmaz_: