| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) ![]() Pfam PF06596 |
| Family f.23.40.1: PsbX-like [267615] (2 proteins) |
| Protein automated matches [267680] (2 species) not a true protein |
| Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (27 PDB entries) |
| Domain d7edax_: 7eda X: [418090] Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edae_, d7edaf_, d7edah_, d7edaj_, d7edak_, d7edal_, d7edam_, d7edao_, d7edat_, d7edau_ automated match to d4il6x_ complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 7eda (more details), 2.78 Å
SCOPe Domain Sequences for d7edax_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7edax_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqr
Timeline for d7edax_: