Lineage for d7edat_ (7eda T:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026547Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) (S)
    automatically mapped to Pfam PF01405
  5. 3026548Family f.23.34.1: PsbT-like [161030] (2 proteins)
    Pfam PF01405
  6. 3026549Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)
  7. 3026564Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (24 PDB entries)
  8. 3026584Domain d7edat_: 7eda T: [418088]
    Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edae_, d7edaf_, d7edah_, d7edaj_, d7edak_, d7edal_, d7edam_, d7edao_, d7edau_, d7edax_
    automated match to d3a0ht_
    complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl

Details for d7edat_

PDB Entry: 7eda (more details), 2.78 Å

PDB Description: structure of monomeric photosystem ii
PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d7edat_:

Sequence, based on SEQRES records: (download)

>d7edat_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvfifaciialfffaiffrepprit

Sequence, based on observed residues (ATOM records): (download)

>d7edat_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvifaciialfffaiffrepprit

SCOPe Domain Coordinates for d7edat_:

Click to download the PDB-style file with coordinates for d7edat_.
(The format of our PDB-style files is described here.)

Timeline for d7edat_:

  • d7edat_ is new in SCOPe 2.08-stable