Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) automatically mapped to Pfam PF01405 |
Family f.23.34.1: PsbT-like [161030] (2 proteins) Pfam PF01405 |
Protein Photosystem II reaction center protein T, PsbT [161031] (3 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (24 PDB entries) |
Domain d7edat_: 7eda T: [418088] Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edae_, d7edaf_, d7edah_, d7edaj_, d7edak_, d7edal_, d7edam_, d7edao_, d7edau_, d7edax_ automated match to d3a0ht_ complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 7eda (more details), 2.78 Å
SCOPe Domain Sequences for d7edat_:
Sequence, based on SEQRES records: (download)
>d7edat_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]} metityvfifaciialfffaiffrepprit
>d7edat_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]} metityvifaciialfffaiffrepprit
Timeline for d7edat_: