Lineage for d7edaf_ (7eda F:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026744Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 3026745Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 3026798Protein automated matches [191000] (6 species)
    not a true protein
  7. 3026823Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (16 PDB entries)
  8. 3026842Domain d7edaf_: 7eda F: [418081]
    Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edah_, d7edaj_, d7edak_, d7edal_, d7edam_, d7edao_, d7edat_, d7edau_, d7edax_
    automated match to d7nhof_
    complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl

Details for d7edaf_

PDB Entry: 7eda (more details), 2.78 Å

PDB Description: structure of monomeric photosystem ii
PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d7edaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7edaf_ f.23.38.1 (F:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d7edaf_:

Click to download the PDB-style file with coordinates for d7edaf_.
(The format of our PDB-style files is described here.)

Timeline for d7edaf_:

  • d7edaf_ is new in SCOPe 2.08-stable