Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) automatically mapped to Pfam PF02935 |
Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins) |
Protein automated matches [191231] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [189652] (7 PDB entries) |
Domain d7d5xl_: 7d5x L: [417925] Other proteins in same PDB: d7d5xa_, d7d5xb1, d7d5xb2, d7d5xc_, d7d5xd_, d7d5xe_, d7d5xf_, d7d5xg_, d7d5xh_, d7d5xi_, d7d5xj_, d7d5xk_, d7d5xm_, d7d5xn_, d7d5xo1, d7d5xo2, d7d5xp_, d7d5xq_, d7d5xr_, d7d5xs_, d7d5xt_, d7d5xu_, d7d5xv_, d7d5xw_, d7d5xx_, d7d5xz_ automated match to d2occl_ complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, oxy, pek, pgv, po4, psc, tgl, zn |
PDB Entry: 7d5x (more details), 1.74 Å
SCOPe Domain Sequences for d7d5xl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d5xl_ f.23.6.1 (L:) automated matches {Cow (Bos taurus) [TaxId: 9913]} hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
Timeline for d7d5xl_:
View in 3D Domains from other chains: (mouse over for more information) d7d5xa_, d7d5xb1, d7d5xb2, d7d5xc_, d7d5xd_, d7d5xe_, d7d5xf_, d7d5xg_, d7d5xh_, d7d5xi_, d7d5xj_, d7d5xk_, d7d5xm_, d7d5xn_, d7d5xo1, d7d5xo2, d7d5xp_, d7d5xq_, d7d5xr_, d7d5xs_, d7d5xt_, d7d5xu_, d7d5xv_, d7d5xw_, d7d5xx_, d7d5xy_, d7d5xz_ |