Lineage for d7d5xi_ (7d5x I:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025021Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) (S)
    automatically mapped to Pfam PF02937
  5. 3025022Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)
  6. 3025023Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3025024Species Cow (Bos taurus) [TaxId:9913] [81412] (57 PDB entries)
  8. 3025069Domain d7d5xi_: 7d5x I: [417922]
    Other proteins in same PDB: d7d5xa_, d7d5xb1, d7d5xb2, d7d5xc_, d7d5xd_, d7d5xe_, d7d5xf_, d7d5xg_, d7d5xh_, d7d5xj_, d7d5xk_, d7d5xl_, d7d5xm_, d7d5xn_, d7d5xo1, d7d5xo2, d7d5xp_, d7d5xq_, d7d5xr_, d7d5xs_, d7d5xt_, d7d5xu_, d7d5xw_, d7d5xx_, d7d5xy_, d7d5xz_
    automated match to d1occi_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, oxy, pek, pgv, po4, psc, tgl, zn

Details for d7d5xi_

PDB Entry: 7d5x (more details), 1.74 Å

PDB Description: bovine heart cytochrome c oxidase in a catalytic intermediate, io10, at 1.74 angstrom resolution
PDB Compounds: (I:) Cytochrome c oxidase subunit 6C

SCOPe Domain Sequences for d7d5xi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d5xi_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

SCOPe Domain Coordinates for d7d5xi_:

Click to download the PDB-style file with coordinates for d7d5xi_.
(The format of our PDB-style files is described here.)

Timeline for d7d5xi_:

  • d7d5xi_ is new in SCOPe 2.08-stable