![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) ![]() automatically mapped to Pfam PF02284 |
![]() | Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins) |
![]() | Protein automated matches [254653] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [255695] (7 PDB entries) |
![]() | Domain d7d5xe_: 7d5x E: [417918] Other proteins in same PDB: d7d5xa_, d7d5xb1, d7d5xb2, d7d5xc_, d7d5xd_, d7d5xf_, d7d5xg_, d7d5xh_, d7d5xi_, d7d5xj_, d7d5xk_, d7d5xl_, d7d5xm_, d7d5xn_, d7d5xo1, d7d5xo2, d7d5xp_, d7d5xq_, d7d5xs_, d7d5xt_, d7d5xu_, d7d5xv_, d7d5xw_, d7d5xx_, d7d5xy_, d7d5xz_ automated match to d1ocre_ complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, oxy, pek, pgv, po4, psc, tgl, zn |
PDB Entry: 7d5x (more details), 1.74 Å
SCOPe Domain Sequences for d7d5xe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d5xe_ a.118.11.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]} hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d7d5xe_:
![]() Domains from other chains: (mouse over for more information) d7d5xa_, d7d5xb1, d7d5xb2, d7d5xc_, d7d5xd_, d7d5xf_, d7d5xg_, d7d5xh_, d7d5xi_, d7d5xj_, d7d5xk_, d7d5xl_, d7d5xm_, d7d5xn_, d7d5xo1, d7d5xo2, d7d5xp_, d7d5xq_, d7d5xr_, d7d5xs_, d7d5xt_, d7d5xu_, d7d5xv_, d7d5xw_, d7d5xx_, d7d5xy_, d7d5xz_ |