SCOPe 2.08: Domain d7d5xe_: 7d5x E:

Lineage for d7d5xe_ (7d5x E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families)
   automatically mapped to Pfam PF02284

5. Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)

6. Protein automated matches [254653] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255695] (7 PDB entries)

8. Domain d7d5xe_: 7d5x E: [417918]
   Other proteins in same PDB: d7d5xa_, d7d5xb1, d7d5xb2, d7d5xc_, d7d5xd_, d7d5xf_, d7d5xg_, d7d5xh_, d7d5xi_, d7d5xj_, d7d5xk_, d7d5xl_, d7d5xm_, d7d5xn_, d7d5xo1, d7d5xo2, d7d5xp_, d7d5xq_, d7d5xs_, d7d5xt_, d7d5xu_, d7d5xv_, d7d5xw_, d7d5xx_, d7d5xy_, d7d5xz_
   automated match to d1ocre_
   complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, oxy, pek, pgv, po4, psc, tgl, zn

Details for d7d5xe_

PDB Entry: 7d5x, 1.74 Å

PDB Description: bovine heart cytochrome c oxidase in a catalytic intermediate, io10, at 1.74 angstrom resolution

PDB Compounds: (E:) cytochrome c oxidase subunit 5a, mitochondrial

SCOPe Domain Sequences for d7d5xe_:

Sequence; same for both SEQRES and ATOM records:

>d7d5xe_ a.118.11.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

Timeline for d7d5xe_:

• d7d5xe_ is new in SCOPe 2.08-stable