| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) ![]() automatically mapped to Pfam PF02285 |
| Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins) |
| Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
| Species Cow (Bos taurus) [TaxId:9913] [81428] (33 PDB entries) |
| Domain d7d5wz_: 7d5w Z: [417912] Other proteins in same PDB: d7d5wa_, d7d5wb1, d7d5wb2, d7d5wc_, d7d5wd_, d7d5we_, d7d5wf_, d7d5wg_, d7d5wh_, d7d5wi_, d7d5wj_, d7d5wk_, d7d5wl_, d7d5wn_, d7d5wo1, d7d5wo2, d7d5wp_, d7d5wq_, d7d5wr_, d7d5ws_, d7d5wt_, d7d5wu_, d7d5wv_, d7d5ww_, d7d5wx_, d7d5wy_ automated match to d1v54m_ complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, po4, psc, tgl, zn |
PDB Entry: 7d5w (more details), 1.84 Å
SCOPe Domain Sequences for d7d5wz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d5wz_ f.23.7.1 (Z:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
Timeline for d7d5wz_:
View in 3DDomains from other chains: (mouse over for more information) d7d5wa_, d7d5wb1, d7d5wb2, d7d5wc_, d7d5wd_, d7d5we_, d7d5wf_, d7d5wg_, d7d5wh_, d7d5wi_, d7d5wj_, d7d5wk_, d7d5wl_, d7d5wm_, d7d5wn_, d7d5wo1, d7d5wo2, d7d5wp_, d7d5wq_, d7d5wr_, d7d5ws_, d7d5wt_, d7d5wu_, d7d5wv_, d7d5ww_, d7d5wx_, d7d5wy_ |