Lineage for d7d5wp_ (7d5w P:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027151Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 3027152Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) (S)
    automatically mapped to Pfam PF00510
  5. 3027153Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 3027166Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 3027167Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries)
  8. 3027223Domain d7d5wp_: 7d5w P: [417902]
    Other proteins in same PDB: d7d5wa_, d7d5wb1, d7d5wb2, d7d5wd_, d7d5we_, d7d5wf_, d7d5wg_, d7d5wh_, d7d5wi_, d7d5wj_, d7d5wk_, d7d5wl_, d7d5wm_, d7d5wn_, d7d5wo1, d7d5wo2, d7d5wq_, d7d5wr_, d7d5ws_, d7d5wt_, d7d5wu_, d7d5wv_, d7d5ww_, d7d5wx_, d7d5wy_, d7d5wz_
    automated match to d3ag3c_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, po4, psc, tgl, zn

Details for d7d5wp_

PDB Entry: 7d5w (more details), 1.84 Å

PDB Description: bovine heart cytochrome c oxidase in a catalytic intermediate of o at 1.84 angstrom resolution
PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d7d5wp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d5wp_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d7d5wp_:

Click to download the PDB-style file with coordinates for d7d5wp_.
(The format of our PDB-style files is described here.)

Timeline for d7d5wp_:

  • d7d5wp_ is new in SCOPe 2.08-stable