Lineage for d7cp5o2 (7cp5 O:91-227)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771043Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2771044Protein Cytochrome c oxidase [49544] (4 species)
  7. 2771045Species Cow (Bos taurus) [TaxId:9913] [49545] (50 PDB entries)
  8. 2771093Domain d7cp5o2: 7cp5 O:91-227 [417852]
    Other proteins in same PDB: d7cp5a_, d7cp5b1, d7cp5c_, d7cp5d_, d7cp5e_, d7cp5f_, d7cp5g_, d7cp5h_, d7cp5i_, d7cp5j_, d7cp5k_, d7cp5l_, d7cp5m_, d7cp5n_, d7cp5o1, d7cp5p_, d7cp5q_, d7cp5r_, d7cp5s_, d7cp5t_, d7cp5u_, d7cp5v_, d7cp5w_, d7cp5x_, d7cp5y_, d7cp5z_
    automated match to d1occb1
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, po4, psc, tgl, zn

Details for d7cp5o2

PDB Entry: 7cp5 (more details), 1.76 Å

PDB Description: bovine heart cytochrome c oxidase in a catalytic intermediate of e at 1.76 angstrom resolution
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d7cp5o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cp5o2 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d7cp5o2:

Click to download the PDB-style file with coordinates for d7cp5o2.
(The format of our PDB-style files is described here.)

Timeline for d7cp5o2:

  • d7cp5o2 is new in SCOPe 2.08-stable