SCOPe 2.08: Domain d7a6ob_: 7a6o B:

Lineage for d7a6ob_ (7a6o B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d7a6ob_: 7a6o B: [417536]
   Other proteins in same PDB: d7a6oa_
   automated match to d4nbxb_
   complexed with so4

Details for d7a6ob_

PDB Entry: 7a6o, 2.12 Å

PDB Description: crystal structure of the complex of the recombinant von willebrand factor aim-a1 domain and vhh81 at 2.1 angstrom resolution

PDB Compounds: (B:) VHH81 Nanobody fragment

SCOPe Domain Sequences for d7a6ob_:

Sequence; same for both SEQRES and ATOM records:

>d7a6ob_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlvesggglvqpggslrlscaasgrtfsynpmgwfrqapgkgrelvaaisrtggstyy
pdsvegrftisrdnakrmvylqmnslraedtavyycaaagvraedgrvrtlpseytfwgq
gtqvtvss

Timeline for d7a6ob_:

• d7a6ob_ is new in SCOPe 2.08-stable