Lineage for d1ds5a_ (1ds5 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2589005Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 2589258Species Maize (Zea mays) [TaxId:4577] [56143] (34 PDB entries)
  8. 2589294Domain d1ds5a_: 1ds5 A: [41669]
    complexed with amp, mg

Details for d1ds5a_

PDB Entry: 1ds5 (more details), 3.16 Å

PDB Description: dimeric crystal structure of the alpha subunit in complex with two beta peptides mimicking the architecture of the tetrameric protein kinase ck2 holoenzyme.
PDB Compounds: (A:) casein kinase, alpha chain

SCOPe Domain Sequences for d1ds5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ds5a_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]}
mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
rydhqerltaleamthpyfqqvraaens

SCOPe Domain Coordinates for d1ds5a_:

Click to download the PDB-style file with coordinates for d1ds5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ds5a_: