SCOP 1.65: Domain d4erk__: 4erk -

Lineage for d4erk__ (4erk -)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (41 proteins)
   members organised in the groups and subfamiles specified by the comments

6. Protein MAP kinase Erk2 [56134] (2 species)
   CMGC group; ERK/MAPK subfamily; serine/threonine kinase

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56136] (5 PDB entries)

8. Domain d4erk__: 4erk - [41656]
   complexed with olo, so4

Details for d4erk__

PDB Entry: 4erk, 2.2 Å

PDB Description: the complex structure of the map kinase erk2/olomoucine

SCOP Domain Sequences for d4erk__:

Sequence; same for both SEQRES and ATOM records:

>d4erk__ d.144.1.7 (-) MAP kinase Erk2 {Rat (Rattus norvegicus)}
aagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqr
tlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhic
yflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgfltey
vatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgsp
sqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqa
lahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpg

Timeline for d4erk__:

• d4erk__ first appeared (with stable ids) in SCOP 1.55
  
• d4erk__ appears in SCOP 1.63
  
• d4erk__ appears in SCOP 1.67
  
• d4erk__ appears in the current release, SCOPe 2.08, called d4erka_