SCOPe 2.07: Domain d1phka_: 1phk A:

Lineage for d1phka_ (1phk A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein gamma-subunit of glycogen phosphorylase kinase (Phk) [56122] (1 species)
   CaMK group; CAMKI subfamily; serine/threonine kinase

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [56123] (3 PDB entries)

8. Domain d1phka_: 1phk A: [41635]
   complexed with atp, mn

Details for d1phka_

PDB Entry: 1phk, 2.2 Å

PDB Description: two structures of the catalytic domain of phosphorylase, kinase: an active protein kinase complexed with nucleotide, substrate-analogue and product

PDB Compounds: (A:) phosphorylase kinase

SCOPe Domain Sequences for d1phka_:

Sequence; same for both SEQRES and ATOM records:

>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
fyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsaeevqelreatlkev
dilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvtlseketrkimrall
evicalhklnivhrdlkpenilldddmnikltdfgfscqldpgeklrevcgtpsylapei
iecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrmimsgnyqfgspewd
dysdtvkdlvsrflvvqpqkrytaeealahpffqqyv

Timeline for d1phka_:

• d1phka_ first appeared (with stable ids) in SCOP 1.55, called d1phk__
  
• d1phka_ appears in SCOPe 2.06
  
• d1phka_ appears in the current release, SCOPe 2.08