Lineage for d1ckmb2 (1ckm B:11-238)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432977Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1433387Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (5 families) (S)
    has a circularly permuted topology
  5. 1433436Family d.142.2.3: mRNA capping enzyme [56100] (2 proteins)
    automatically mapped to Pfam PF01331
  6. 1433441Protein RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain [56101] (1 species)
  7. 1433442Species Chlorella virus PBCV-1 [TaxId:10506] [56102] (3 PDB entries)
  8. 1433444Domain d1ckmb2: 1ckm B:11-238 [41586]
    Other proteins in same PDB: d1ckma1, d1ckmb1
    protein/RNA complex; complexed with gtp

Details for d1ckmb2

PDB Entry: 1ckm (more details), 2.5 Å

PDB Description: structure of two different conformations of mrna capping enzyme in complex with gtp
PDB Compounds: (B:) mRNA capping enzyme

SCOPe Domain Sequences for d1ckmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckmb2 d.142.2.3 (B:11-238) RNA guanylyltransferase (mRNA capping enzyme), N-terminal domain {Chlorella virus PBCV-1 [TaxId: 10506]}
nitteravltlnglqiklhkvvgesrddivakmkdlamddhkfprlpgpnpvsierkdfe
klkqnkyvvsektdgirfmmfftrvfgfkvctiidramtvyllpfkniprvlfqgsifdg
elcvdivekkfafvlfdavvvsgvtvsqmdlasrffamkrslkefknvpedpailrykew
iplehptiikdhlkkanaiyhtdgliimsvdepviygrnfnlfklkpg

SCOPe Domain Coordinates for d1ckmb2:

Click to download the PDB-style file with coordinates for d1ckmb2.
(The format of our PDB-style files is described here.)

Timeline for d1ckmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ckmb1