Lineage for d3aopa4 (3aop A:426-570)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584195Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 2584196Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 2584197Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)
  6. 2584246Protein Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56016] (1 species)
  7. 2584247Species Escherichia coli [TaxId:562] [56017] (12 PDB entries)
  8. 2584261Domain d3aopa4: 3aop A:426-570 [41432]
    Other proteins in same PDB: d3aopa1, d3aopa2
    complexed with k, po4, sf4, srm

Details for d3aopa4

PDB Entry: 3aop (more details), 2.1 Å

PDB Description: sulfite reductase hemoprotein photoreduced with proflavine edta, siroheme feii,[4fe-4s] +1, phosphate bound
PDB Compounds: (A:) sulfite reductase hemoprotein

SCOPe Domain Sequences for d3aopa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aopa4 d.134.1.1 (A:426-570) Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 {Escherichia coli [TaxId: 562]}
pqrensmacvsfptcplamaeaerflpsfidnidnlmakhgvsdehivmrvtgcpngcgr
amlaevglvgkapgrynlhlggnrigtriprmykenitepeilasldeligrwakereag
egfgdftvragiirpvldpardlwd

SCOPe Domain Coordinates for d3aopa4:

Click to download the PDB-style file with coordinates for d3aopa4.
(The format of our PDB-style files is described here.)

Timeline for d3aopa4: