Lineage for d4qqzg4 (4qqz G:824-944)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3012359Fold d.401: Cas3 C-terminal domain-like [418727] (1 superfamily)
    3 layers; central antiparallel beta strands surrounded by several helices and loops
  4. 3012360Superfamily d.401.1: Cas3 C-terminal domain-like [418770] (1 family) (S)
  5. 3012361Family d.401.1.1: Cas3 C-terminal domain-like [418855] (1 protein)
    Pfam PF18395
  6. 3012362Protein CRISPR-associated protein Cas3 [419204] (1 species)
  7. 3012363Species Thermobifida fusca [TaxId:269800] [419717] (3 PDB entries)
  8. 3012371Domain d4qqzg4: 4qqz G:824-944 [414221]
    Other proteins in same PDB: d4qqza1, d4qqza2, d4qqza3, d4qqzc1, d4qqzc2, d4qqzc3, d4qqze1, d4qqze2, d4qqze3, d4qqzg1, d4qqzg2, d4qqzg3
    automated match to d4qqwa4
    protein/DNA complex; complexed with anp, fe

Details for d4qqzg4

PDB Entry: 4qqz (more details), 2.93 Å

PDB Description: Crystal structure of T. fusca Cas3-AMPPNP
PDB Compounds: (G:) CRISPR-associated helicase, Cas3 family

SCOPe Domain Sequences for d4qqzg4:

Sequence, based on SEQRES records: (download)

>d4qqzg4 d.401.1.1 (G:824-944) CRISPR-associated protein Cas3 {Thermobifida fusca [TaxId: 269800]}
vlatrfgagsvrvlcyyvdtagnrwldpectvefpeqgtgregrftmadcrdlvartipv
rmgpwasqltednhppeawresfylrdlvlipqrvtdegavlptetggrewlldpckgli
f

Sequence, based on observed residues (ATOM records): (download)

>d4qqzg4 d.401.1.1 (G:824-944) CRISPR-associated protein Cas3 {Thermobifida fusca [TaxId: 269800]}
vlatrfgagsvrvlcyyvtagnrwldpectvefpeqgtgregrftmadcrdlvartipvr
mgpwasqltednhppeawresfylrdlvlipqavlptetggrewlldpckglif

SCOPe Domain Coordinates for d4qqzg4:

Click to download the PDB-style file with coordinates for d4qqzg4.
(The format of our PDB-style files is described here.)

Timeline for d4qqzg4:

  • d4qqzg4 is new in SCOPe 2.08-stable