Lineage for d4qqye1 (4qqy E:14-259)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737164Family a.211.1.7: HD domain from Cas3-like [418854] (1 protein)
    Pfam PF12252
  6. 2737165Protein CRISPR-associated protein Cas3 [419201] (1 species)
  7. 2737166Species Thermobifida fusca [TaxId:269800] [419713] (3 PDB entries)
  8. 2737177Domain d4qqye1: 4qqy E:14-259 [414198]
    Other proteins in same PDB: d4qqya2, d4qqya3, d4qqya4, d4qqyc2, d4qqyc3, d4qqyc4, d4qqye2, d4qqye3, d4qqye4, d4qqyg2, d4qqyg3, d4qqyg4
    automated match to d4qqwa1
    protein/DNA complex; complexed with adp, fe

Details for d4qqye1

PDB Entry: 4qqy (more details), 3.12 Å

PDB Description: Crystal structure of T. fusca Cas3-ADP
PDB Compounds: (E:) CRISPR-associated helicase, Cas3 family

SCOPe Domain Sequences for d4qqye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qqye1 a.211.1.7 (E:14-259) CRISPR-associated protein Cas3 {Thermobifida fusca [TaxId: 269800]}
ppldlrfwakerglrgktyplvchsldaaaaalvlwneylspglrdtiassmetdeehag
hciafwaglhdigkltrefqqqiaidlsaypgeelsgeqrshaaatgkwlpfalpslgyp
ngglvtglvaqmlgghhgtfhphpsfqsrnplaefgfssphwekqrhallhavfdatgrp
tppdmldgptasvvcglviladwlvsqedfllerltslpadgsasalrahfetslrrips
lldaag

SCOPe Domain Coordinates for d4qqye1:

Click to download the PDB-style file with coordinates for d4qqye1.
(The format of our PDB-style files is described here.)

Timeline for d4qqye1:

  • d4qqye1 is new in SCOPe 2.08-stable