Lineage for d4qqwc4 (4qqw C:824-944)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3012359Fold d.401: Cas3 C-terminal domain-like [418727] (1 superfamily)
    3 layers; central antiparallel beta strands surrounded by several helices and loops
  4. 3012360Superfamily d.401.1: Cas3 C-terminal domain-like [418770] (1 family) (S)
  5. 3012361Family d.401.1.1: Cas3 C-terminal domain-like [418855] (1 protein)
    Pfam PF18395
  6. 3012362Protein CRISPR-associated protein Cas3 [419204] (1 species)
  7. 3012363Species Thermobifida fusca [TaxId:269800] [419717] (3 PDB entries)
  8. 3012365Domain d4qqwc4: 4qqw C:824-944 [414181]
    Other proteins in same PDB: d4qqwa1, d4qqwa2, d4qqwa3, d4qqwc1, d4qqwc2, d4qqwc3, d4qqwe1, d4qqwe2, d4qqwe3, d4qqwg1, d4qqwg2, d4qqwg3
    automated match to d4qqwa4
    protein/DNA complex; complexed with fe

Details for d4qqwc4

PDB Entry: 4qqw (more details), 2.66 Å

PDB Description: Crystal structure of T. fusca Cas3
PDB Compounds: (C:) CRISPR-associated helicase, Cas3 family

SCOPe Domain Sequences for d4qqwc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qqwc4 d.401.1.1 (C:824-944) CRISPR-associated protein Cas3 {Thermobifida fusca [TaxId: 269800]}
vlatrfgagsvrvlcyyvdtagnrwldpectvefpeqgtgregrftmadcrdlvartipv
rmgpwasqltednhppeawresfylrdlvlipqrvtdegavlptetggrewlldpckgli
f

SCOPe Domain Coordinates for d4qqwc4:

Click to download the PDB-style file with coordinates for d4qqwc4.
(The format of our PDB-style files is described here.)

Timeline for d4qqwc4:

  • d4qqwc4 is new in SCOPe 2.08-stable