SCOP 1.63: Domain d1volb2: 1vol B:116-198

Lineage for d1volb2 (1vol B:116-198)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.129: TBP-like [55944] (4 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)
   structure of the N-terminal domain is not known yet

7. Species Arabidopsis thaliana [TaxId:3702] [55949] (13 PDB entries)

8. Domain d1volb2: 1vol B:116-198 [41275]
   Other proteins in same PDB: d1vola1, d1vola2
   protein/DNA complex

Details for d1volb2

PDB Entry: 1vol, 2.7 Å

PDB Description: tfiib (human core domain)/tbp (a.thaliana)/tata element ternary complex

SCOP Domain Sequences for d1volb2:

Sequence; same for both SEQRES and ATOM records:

>d1volb2 d.129.1.1 (B:116-198) TATA-box binding protein (TBP), C-terminal domain {Arabidopsis thaliana}
qnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitga
kmrdetykafeniypvlsefrki

Timeline for d1volb2:

• d1volb2 first appeared (with stable ids) in SCOP 1.55
  
• d1volb2 appears in SCOP 1.61
  
• d1volb2 appears in SCOP 1.65
  
• d1volb2 appears in the current release, SCOPe 2.08