Lineage for d1qn3a2 (1qn3 A:116-198)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196532Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 196533Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 196534Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
  6. 196535Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)
  7. 196536Species Arabidopsis thaliana [TaxId:3702] [55949] (13 PDB entries)
  8. 196562Domain d1qn3a2: 1qn3 A:116-198 [41251]

Details for d1qn3a2

PDB Entry: 1qn3 (more details), 1.95 Å

PDB Description: crystal structure of the c(-25) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.

SCOP Domain Sequences for d1qn3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qn3a2 d.129.1.1 (A:116-198) TATA-box binding protein (TBP), C-terminal domain {Arabidopsis thaliana}
qnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifvsgkivitga
kmrdetykafeniypvlsefrki

SCOP Domain Coordinates for d1qn3a2:

Click to download the PDB-style file with coordinates for d1qn3a2.
(The format of our PDB-style files is described here.)

Timeline for d1qn3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qn3a1