Lineage for d1vokb1 (1vok B:12-115)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2581739Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2581740Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 2581741Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 2581800Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [55949] (13 PDB entries)
  8. 2581819Domain d1vokb1: 1vok B:12-115 [41244]
    complexed with so4

Details for d1vokb1

PDB Entry: 1vok (more details), 2.1 Å

PDB Description: arabidopsis thaliana tbp (dimer)
PDB Compounds: (B:) tata-box-binding protein

SCOPe Domain Sequences for d1vokb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vokb1 d.129.1.1 (B:12-115) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktta
lifasgkmvctgaksedfskmaarkyarivqklgfpakfkdfki

SCOPe Domain Coordinates for d1vokb1:

Click to download the PDB-style file with coordinates for d1vokb1.
(The format of our PDB-style files is described here.)

Timeline for d1vokb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vokb2