SCOPe 2.08: Domain d6dfih1: 6dfi H:6-215

Lineage for d6dfih1 (6dfi H:6-215)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6dfih1: 6dfi H:6-215 [410986]
   Other proteins in same PDB: d6dfie_, d6dfih2, d6dfil1, d6dfil2
   automated match to d6shgh_

Details for d6dfih1

PDB Entry: 6dfi, 2.48 Å

PDB Description: crystal structure of anti-zika antibody z021 bound to zika virus envelope protein diii

PDB Compounds: (H:) anti-Zika antibody Z021, Heavy Chain

SCOPe Domain Sequences for d6dfih1:

Sequence; same for both SEQRES and ATOM records:

>d6dfih1 b.1.1.0 (H:6-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsetlsltctvsggsidtyywswirqtpgkglewigcfyysvdnhfnpsles
rvtisvdtsknqfslkmtsmtasdtavyycarnqpggrafdywgpgtlvtvssastkgps
vfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkrvepks

Timeline for d6dfih1:

• d6dfih1 is new in SCOPe 2.08-stable