Lineage for d1soxa2 (1sox A:3-93)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667266Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 1667267Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 1667268Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 1667331Protein Sulfite oxidase, N-terminal domain [55866] (2 species)
  7. 1667332Species Chicken (Gallus gallus) [TaxId:9031] [55867] (1 PDB entry)
  8. 1667333Domain d1soxa2: 1sox A:3-93 [41090]
    Other proteins in same PDB: d1soxa1, d1soxa3, d1soxb1, d1soxb3
    complexed with epe, gol, hem, mo, mte, so4

Details for d1soxa2

PDB Entry: 1sox (more details), 1.9 Å

PDB Description: sulfite oxidase from chicken liver
PDB Compounds: (A:) sulfite oxidase

SCOPe Domain Sequences for d1soxa2:

Sequence, based on SEQRES records: (download)

>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
sypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwaly
avhgephvlellqqykvgelspdeapaapda

Sequence, based on observed residues (ATOM records): (download)

>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
sypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwaly
avhgephvlellqqykvgelspdeapapda

SCOPe Domain Coordinates for d1soxa2:

Click to download the PDB-style file with coordinates for d1soxa2.
(The format of our PDB-style files is described here.)

Timeline for d1soxa2: