Lineage for d1b49a_ (1b49 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428979Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1428980Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1428981Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1429006Protein dCMP hydroxymethylase [55843] (1 species)
  7. 1429007Species Bacteriophage T4 [TaxId:10665] [55844] (3 PDB entries)
  8. 1429012Domain d1b49a_: 1b49 A: [41060]
    complexed with po4

Details for d1b49a_

PDB Entry: 1b49 (more details), 2.3 Å

PDB Description: dcmp hydroxymethylase from t4 (phosphate-bound)
PDB Compounds: (A:) protein (deoxycytidylate hydroxymethylase)

SCOPe Domain Sequences for d1b49a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b49a_ d.117.1.1 (A:) dCMP hydroxymethylase {Bacteriophage T4 [TaxId: 10665]}
misdsmtveeirlhlglalkekdfvvdktgvktieiigasfvadepfifgalndeyiqre
lewykskslfvkdipgetpkiwqqvasskgeinsnygwaiwsednyaqydmclaelgqnp
dsrrgimiytrpsmqfdynkdgmsdfmctntvqylirdkkinavvnmrsndvvfgfrndy
awqkyvldklvsdlnagdstrqykagsiiwnvgslhvysrhfylvdhwwktgethiskkd
y

SCOPe Domain Coordinates for d1b49a_:

Click to download the PDB-style file with coordinates for d1b49a_.
(The format of our PDB-style files is described here.)

Timeline for d1b49a_: