Lineage for d5viga_ (5vig A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743601Domain d5viga_: 5vig A: [410595]
    Other proteins in same PDB: d5vigb1, d5vigb2, d5vigg_, d5vigl1, d5vigl2, d5vigz_
    automated match to d6shgh_
    complexed with flc

Details for d5viga_

PDB Entry: 5vig (more details), 3 Å

PDB Description: crystal structure of anti-zika antibody z006 bound to zika virus envelope protein diii
PDB Compounds: (A:) Fab heavy chain

SCOPe Domain Sequences for d5viga_:

Sequence, based on SEQRES records: (download)

>d5viga_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqllesggglvqpggslrlscaasgftfknyamawvrqapgkglewvsllynseestyya
dsvkgrftisrdnskntlflqmnrlrvedtavyfcvrdrsngwssinlwgrgtlvtvssa
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records): (download)

>d5viga_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqllesggglvqpggslrlscaasgftfknyamawvrqapgkglewvsllynseestyya
dsvkgrftisrdnskntlflqmnrlrvedtavyfcvrdrsngwssinlwgrgtlvtvssa
stkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkrvep

SCOPe Domain Coordinates for d5viga_:

Click to download the PDB-style file with coordinates for d5viga_.
(The format of our PDB-style files is described here.)

Timeline for d5viga_:

  • d5viga_ is new in SCOPe 2.08-stable