SCOPe 2.03: Domain d1bkob_: 1bko B:

Lineage for d1bkob_ (1bko B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Bacillus subtilis [TaxId:1423] [55836] (5 PDB entries)

8. Domain d1bkob_: 1bko B: [41037]

Details for d1bkob_

PDB Entry: 1bko, 2.75 Å

PDB Description: thermostable thymidylate synthase a from bacillus subtilis

PDB Compounds: (B:) thymidylate synthase a

SCOPe Domain Sequences for d1bkob_:

Sequence; same for both SEQRES and ATOM records:

>d1bkob_ d.117.1.1 (B:) Thymidylate synthase {Bacillus subtilis [TaxId: 1423]}
tqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpilttk
kvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrslng
ekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevrar
sndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqfe
apelwinpevkdfydftiddfklinykhgdkllfevav

Timeline for d1bkob_:

• d1bkob_ first appeared (with stable ids) in SCOP 1.55
  
• d1bkob_ appears in SCOPe 2.02
  
• d1bkob_ appears in SCOPe 2.04
  
• d1bkob_ appears in the current release, SCOPe 2.08