Lineage for d1bspb_ (1bsp B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428979Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1428980Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1428981Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1429014Protein Thymidylate synthase [55833] (7 species)
  7. 1429015Species Bacillus subtilis [TaxId:1423] [55836] (5 PDB entries)
  8. 1429019Domain d1bspb_: 1bsp B: [41032]
    complexed with po4

Details for d1bspb_

PDB Entry: 1bsp (more details), 2.5 Å

PDB Description: thermostable thymidylate synthase a from bacillus subtilis
PDB Compounds: (B:) thymidylate synthase a

SCOPe Domain Sequences for d1bspb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bspb_ d.117.1.1 (B:) Thymidylate synthase {Bacillus subtilis [TaxId: 1423]}
tqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpilttk
kvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrslng
ekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevrar
sndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqfe
apelwinpevkdfydftiddfklinykhgdkllfevav

SCOPe Domain Coordinates for d1bspb_:

Click to download the PDB-style file with coordinates for d1bspb_.
(The format of our PDB-style files is described here.)

Timeline for d1bspb_: