Lineage for d4rgnd1 (4rgn D:9-218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745209Domain d4rgnd1: 4rgn D:9-218 [409548]
    Other proteins in same PDB: d4rgna1, d4rgna2, d4rgnc1, d4rgnc2, d4rgnd2, d4rgne2, d4rgnf2, d4rgng2, d4rgnl1, d4rgnl2, d4rgns1, d4rgns2
    automated match to d6shgh_

Details for d4rgnd1

PDB Entry: 4rgn (more details), 2.7 Å

PDB Description: structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
PDB Compounds: (D:) 6D3 heavy chain

SCOPe Domain Sequences for d4rgnd1:

Sequence, based on SEQRES records: (download)

>d4rgnd1 b.1.1.1 (D:9-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aelvkpgasvklsckasgytftshwmhwvkqrpgqglewigeidpsdsyinynqifegka
tltvdkssttaylqlssltsedsavyycartagllapmdywgqgtsvtvssakttppsvy
plapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvt
vpsstwpsetvtcnvahpasstkvdkkivp

Sequence, based on observed residues (ATOM records): (download)

>d4rgnd1 b.1.1.1 (D:9-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aelvkpgasvklsckasgytftshwmhwvkqrpgqglewigeidpsdsyinynqifegka
tltvdkssttaylqlssltsedsavyycartagllapmdywgqgtsvtvssakttppsvy
plapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvpsstwp
setvtcnvahpasstkvdkkivp

SCOPe Domain Coordinates for d4rgnd1:

Click to download the PDB-style file with coordinates for d4rgnd1.
(The format of our PDB-style files is described here.)

Timeline for d4rgnd1:

  • d4rgnd1 is new in SCOPe 2.08-stable