Lineage for d4oiih1 (4oii H:6-228)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (24 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) 
Domain d4oiih1: 4oii H:6-228 [409313]
Other proteins in same PDB: d4oiih2, d4oiii2, d4oiil1, d4oiil2, d4oiim1, d4oiim2
automated match to d6shgh_
Details for d4oiih1
PDB Entry: 4oii (more details), 3 Å
PDB Description: west nile virus ns1 in complex with neutralizing 22ns1 antibody fab
PDB Compounds: (H:) Heavy Chain of Fab fragment of 22NS1 AntibodySCOPe Domain Sequences for d4oiih1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oiih1 b.1.1.1 (H:6-228) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpgaelvkpgasvklsckasgytftsywmhwvklrpgqgfewigdinpnnggpsynekfk
rkatltvdtssstaymqlssltsedsavyyctiddgyrfgywgqgtlvtvsaakttapsv
yplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssv
tvtsstwpsqsitcnvahpasstkvdkkiepr
SCOPe Domain Coordinates for d4oiih1:
Click to download the PDB-style file with coordinates for d4oiih1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4oiih1:
- d4oiih1 is new in SCOPe 2.08-stable
View in 3D
