SCOPe 2.08: Domain d3uc0i_: 3uc0 I:

Lineage for d3uc0i_ (3uc0 I:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Chimpanzee (Pan troglodytes) [TaxId:9598] [226267] (1 PDB entry)

8. Domain d3uc0i_: 3uc0 I: [408717]
   Other proteins in same PDB: d3uc0l2, d3uc0m2
   automated match to d6shgh_
   complexed with gol, so4

Details for d3uc0i_

PDB Entry: 3uc0, 2.71 Å

PDB Description: crystal structure of domain i of the envelope glycoprotein ectodomain from dengue virus serotype 4 in complex with the fab fragment of the chimpanzee monoclonal antibody 5h2

PDB Compounds: (I:) Heavy chain, monoclonal antibody 5H2

SCOPe Domain Sequences for d3uc0i_:

Sequence, based on SEQRES records:

>d3uc0i_ b.1.1.0 (I:) automated matches {Chimpanzee (Pan troglodytes) [TaxId: 9598]}
evqllesgpglvkpsetlsltctvsggsisdfywswlrqspgkglewigyahsrvsayyn
pslksrvtisvdtsknqislrlsavtaadtalyycarqgtgttgvsedsfdlwgqgtkvi
vslastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
qssglyslssvvtvpssslgtqtyicnvdhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d3uc0i_ b.1.1.0 (I:) automated matches {Chimpanzee (Pan troglodytes) [TaxId: 9598]}
evqllesgpglvkpsetlsltctvsggsisdfywswlrqspgkglewigyahsrvsayyn
pslksrvtisvdtsknqislrlsavtaadtalyycarqgtgttgvsedsfdlwgqgtkvi
vslastkgpsvfplapsstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtqtyicnvdhkpsntkvdkkvep

Timeline for d3uc0i_:

• d3uc0i_ is new in SCOPe 2.08-stable