![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
![]() | Domain d3q3gk1: 3q3g K:11-226 [408595] Other proteins in same PDB: d3q3ga1, d3q3ga2, d3q3gb2, d3q3gc1, d3q3gc2, d3q3gd2, d3q3ge_, d3q3gf1, d3q3gf2, d3q3gg_, d3q3gh2, d3q3gi_, d3q3gj1, d3q3gj2, d3q3gk2, d3q3gl_ automated match to d6shgh_ complexed with ca, cl, edo, gol, na, peg |
PDB Entry: 3q3g (more details), 2.7 Å
SCOPe Domain Sequences for d3q3gk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q3gk1 b.1.1.1 (K:11-226) automated matches {Mouse (Mus musculus) [TaxId: 10090]} aelvkpgasvklsctpsgfnikdiymqwvkqrpeqglewigridpandktkydpkfqgka titadtssntaylqlssltsedtavyycaseghygydgyamdywgqgttvtvssakttpp svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss svtvpssprpsetvtcnvahpasstkvdkkivprdc
Timeline for d3q3gk1: